Shen ding logo
Peptide topics

APP Peptide

We provide quality APP Peptide,2mg or more,>95% by HPLC,our 6000+ cataloge peptides are available to research professionals in academic and industrial institution.

     
Cat.No. Name Size
KX10328 APP Peptide: DAEFRADSGYEVAHQKLVFFAEDVGSNKGAIIGLMVGGVV 2mg or more,>95% by HPLC
KZ10329 APP Peptide: DAEFRHDSGYEVHHQK 2mg or more,>95% by HPLC
KC10204 APP Peptide: DAEFRHDSGYEVHHQKLVFFAEDVGSNK 2mg or more,>95% by HPLC
KD10978 APP Peptide: RHDSGYEVHHC 2mg or more,>95% by HPLC
KZ10203 APP Peptide: VHHQKLVFFAEDVGSNK 2mg or more,>95% by HPLC
KD10554 AR Peptide: FNEYRMHKSR 2mg or more,>95% by HPLC
Gumtree Alerts

RECEIVE UPDATES & PROMOTIONS

return top