Logotipo da Shen ding
Tópicos de peptídeos

Peptídeo APP

We provide quality APP Peptide,2mg or more,>95% by HPLC,our 6000+ cataloge peptides are available to research professionals in academic and industrial institution.

Gato não. Nome Tamanho
KX10328 APP Peptide: DAEFRADSGYEVAHQKLVFFAEDVGSNKGAIIGLMVGGVV 2 mg ou mais,> 95% por HPLC
KZ10329 APP Peptide: DAEFRHDSGYEVHHQK 2 mg ou mais,> 95% por HPLC
KC10204 APP Peptide: DAEFRHDSGYEVHHQKLVFFAEDVGSNK 2 mg ou mais,> 95% por HPLC
KD10978 APP Peptide: RHDSGYEVHHC 2 mg ou mais,> 95% por HPLC
KZ10203 APP Peptide: VHHQKLVFFAEDVGSNK 2 mg ou mais,> 95% por HPLC
KD10554 AR Peptide: FNEYRMHKSR 2 mg ou mais,> 95% por HPLC
Alertas Gumtree

RECEBA ATUALIZAÇÕES E PROMOÇÕES

alto retorno