Logotipo da Shen ding
Shen ding
APIs genéricas

Acetato de sermorelina, 86168-78-7

Acetato de sermorelina, 86168-78-7

  • CAS #:86168-78-7
  • Nome do produto:Sermorelin Acetate
  • Tamanho:1g ou mais
  • Habilidade da fonte:500g / duas semanas
  • FOB Preço:Email
  • Condições de pagamento:T / T
  • Prazo de execução:Dentro de 12 horas após o recebimento do pagamento
  • Embalagem:Maneiras discretas de embalagem para passe alfandegário garantidas
  • Entrega:por expresso (FedEx, UPS, DHL, EMS), por via aérea
  • Download:MSDS
  • Contate agora
  • Especificação
  • MSDS
  • Comentários

Sermorelin Acetate-Physiochemical properties

Sequence(Single-Letter Code): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

Sequence(Three-Letter Code): H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2

Número de resíduos: 29aa

Molecular weight: 3357.88 g/mol

Coeficiente de extinção: 2560 M-1cm-1

Ponto isoelétrico: pH 10.77

Carga líquida em pH 7: 4

Estimated solubility: Good water solubility.

Armazenamento: armazenar em local fresco, seco e ventilado

PSA: 1472.20000

LogP: 5.07090

Sermorelin Acetate Description

Alternate Names:Sermorelin Acetate,SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)

Sermorelin is a GHRH (growth hormone–releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 amino acids. This sequence is a portion of the endogenous human GHRH, and is currently considered to be the shortest synthetic peptide that possesses the full array of functional GHRH activity. Due to this fact, sermorelin is considered to be a growth hormone secretagogue.

Sermorelin has been used during research to stimulate the secretion of growth hormone from the adenohypophysis (also called the anterior pituitary). The anterior pituitary secretes trophic hormones. Sermorelin has also been used in research stimulation tests to assess for pituitary sufficiency in relation to the secretion of the growth hormone.

Sermorelin Acetate References

1,A.Prakash and K.L.Goa, BioDrugs, 12, 139 (1999)
2,X.A.Alvarez and R.Cacabelos, Peptides, 14, 707 (1993)
3,J.Pinski et al., Int. J. Pept. Protein Res., 41, 246 (1993)
4,M.Zarandi et al., Int. J. Pept. Protein Res., 39, 211 (1992)
5,M.L.Vance, Clin. Chem., 36, 415 (1990)
6,M.Zarandi et al., Int. J. Pept. Protein Res., 36, 499 (1990)



Caso contrário, conte-me sobre sua sequência específica. Nós fornecemos o síntese de peptídeo customizada para você.

Consulta on-line

Por favor, sinta-se livre para dar sua pergunta na below.We forma respondê-lo em horas 24.

alto retorno