Shen ding logo
Shen ding
Generic APIs

Sermorelin Acetate,86168-78-7

Sermorelin Acetate,86168-78-7

     

  • CAS#:86168-78-7
  • Product Name:Sermorelin Acetate
  • Size:1g or more
  • Supply Ability:500g/two weeks
  • FOB Price:Email
  • Payment Terms:T/T
  • Lead time:Within 12 hours after receiving payment
  • Packing:Discreet ways of packing for Customs pass guaranteed
  • Delivery:by express (FedEx,UPS,DHL,EMS), by air
  • Download:MSDS
  • Contact Now
  • Specification
  • MSDS
  • Reviews

Sermorelin Acetate-Physiochemical properties

      Sequence(Single-Letter Code): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

      Sequence(Three-Letter Code): H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2

      Number of residues:     29aa

      Molecular weight:     3357.88 g/mol

      Extinction coefficient: 2560 M-1cm-1

      Iso-electric point:     pH 10.77

      Net charge at pH 7:     4

      Estimated solubility:     Good water solubility.

      Storage:store in cool, dry, ventilated place

      PSA:     1472.20000

      LogP:     5.07090

Sermorelin Acetate Description

      Alternate Names:Sermorelin Acetate,SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)

Sermorelin is a GHRH (growth hormone–releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 amino acids. This sequence is a portion of the endogenous human GHRH, and is currently considered to be the shortest synthetic peptide that possesses the full array of functional GHRH activity. Due to this fact, sermorelin is considered to be a growth hormone secretagogue.

Sermorelin has been used during research to stimulate the secretion of growth hormone from the adenohypophysis (also called the anterior pituitary). The anterior pituitary secretes trophic hormones. Sermorelin has also been used in research stimulation tests to assess for pituitary sufficiency in relation to the secretion of the growth hormone.

Sermorelin Acetate References

1,A.Prakash and K.L.Goa, BioDrugs, 12, 139 (1999)
2,X.A.Alvarez and R.Cacabelos, Peptides, 14, 707 (1993)
3,J.Pinski et al., Int. J. Pept. Protein Res., 41, 246 (1993)
4,M.Zarandi et al., Int. J. Pept. Protein Res., 39, 211 (1992)
5,M.L.Vance, Clin. Chem., 36, 415 (1990)
6,M.Zarandi et al., Int. J. Pept. Protein Res., 36, 499 (1990)



If not, Please tell me about your specific sequence. We provide the custom peptide synthesis for you.

Online Inquiry

Please feel free to give your inquiry in the form below.We will reply you in 24 hours.

  •  
return top